Pay in 4 interest-free payments of $25.02 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
EIF-2alpha
CHSY1 Polyclonal Antibody
Recombinant Human FSH Protein (Flag & His Tag)
TRIM29 Polyclonal Antibody - E-AB-13932 Size:120μL LKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKITRIM29 Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 13932 60, E AB 13932 120, E AB 13932 200 Citations, Manuals and MSDS Available upon request. Abbreviation: TRIM29 Target Synonym: Ataxia telangiectasia group D associated protein; Ataxia telangiectasia group D associated protein; ATDC; FLJ36085; TRI29; TRIM 29; TRIM29; Tripartite motif containing 29; Tripartite motif containing protein 29; Tripartite motif protein 29; Tripartite
US$ 32.95
US$ 32.95
US$ 39.00
US$ 59.00
US$ 59.00
US$ 39.00
US$ 18.00
US$ 16.00